USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl
Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl

Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl

$58.69 inc. tax

Cristal J.G Durand Villemont Bowl Coupe 9 3/4" 24% Lead Crystal Bowl

crystal tabletop decor bowl
serving bowl

Product Code: 106
Brand: J.G Durand
Product Condition: New
Related Products
Prodyne Cb4 Iced Up Sal..
Prodyne Cb4 Iced Up Sal..
$39.95
Badash P350 Serving Bow..
Badash P350 Serving Bow..
$59.99
Gorham Althea Full Lead..
Gorham Althea Full Lead..
$69.00
3 white nesting porcela..
3 white nesting porcela..
$83.94
Mikasa Germany Crystal ..
Mikasa Germany Crystal ..
$149.99
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i